TRIM63 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A3101
Zusätzliche Namen:: IRF|MURF1|MURF2|RNF28|SMRZ|TRIM63
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 40 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGHQ
Uniprot:: Q969Q1
Synonyme:: E3 ubiquitin-protein ligase TRIM63;IRF;iris ring finger protein;MURF1;MURF2;muscle specific ring finger protein 2;muscle-specific RING finger protein 1;ring finger protein 28;RING-type E3 ubiquitin transferase TRIM63;RNF28;SMRZ;striated muscle RING zinc finger protein;tripartite motif containing 63, E3 ubiquitin protein ligase;tripartite motif-containing protein 63
Weitere Details:: This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is an E3 ubiquitin ligase that localizes to the Z-line and M-line lattices of myofibrils. This protein plays an important role in the atrophy of skeletal and cardiac muscle and is required for the degradation of myosin heavy chain proteins, myosin light chain, myosin binding protein, and for muscle-type creatine kinase.