HNF1A Alpha Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3092
Zusätzliche Namen:: HNF-1-alpha|HNF-1A|HNF1|HNF1alpha|HNF1A Alpha|HNF4A|IDDM20|LFB1|MODY3|TCF-1|TCF1
Anwendung:: ELISA, WB
Molekulargewicht:: 81kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQ
Uniprot:: P20823
Synonyme:: albumin proximal factor;hepatic nuclear factor 1;hepatocyte nuclear factor 1-alpha;HNF-1-alpha;HNF-1A;HNF1;HNF1alpha;HNF4A;IDDM20;interferon production regulator factor;LFB1;liver-specific transcription factor LF-B1;MODY3;TCF-1;TCF1;Transcription factor 1;transcription factor 1, hepatic;truncated hepatocyte nuclear factor 1 alpha
Weitere Details:: The protein encoded by this gene is a transcription factor required for the expression of several liver-specific genes. The encoded protein functions as a homodimer and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. Alternative splicing results in multiple transcript variants encoding different isoforms.