Gemin 2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3082
Zusätzliche Namen:: Gemin 2|SIP1|SIP1-delta
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Uniprot:: O14893
Synonyme:: component of gems 2;gem-associated protein 2;gemin-2;SIP1;SIP1-delta;SMN interacting protein 1-delta;survival of motor neuron protein interacting protein 1;Survival of motor neuron protein-interacting protein 1
Weitere Details:: This gene encodes one of the proteins found in the SMN complex, which consists of several gemin proteins and the protein known as the survival of motor neuron protein. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration.