A3082
Gemin 2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A3082
- Zusätzliche Namen:
- Gemin 2|SIP1|SIP1-delta
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 35kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
- Uniprot:
- O14893
- Synonyme:
- component of gems 2;gem-associated protein 2;gemin-2;SIP1;SIP1-delta;SMN interacting protein 1-delta;survival of motor neuron protein interacting protein 1;Survival of motor neuron protein-interacting protein 1
- Weitere Details:
- This gene encodes one of the proteins found in the SMN complex, which consists of several gemin proteins and the protein known as the survival of motor neuron protein. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration.
- Versandbedingungen:
- Blue Ice







