PIWIL2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A3073
Zusätzliche Namen:: CT80|HILI|mili|PIWIL1L|PIWIL2
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LGRGLSANLVRKDREELSPTFWDPKVLAAGDSKMAETSVGWSRTLGRGSSDASLLPLGRAAGGISREVDKPPCTFSTPSRGPPQLSSPPALPQSPLHSPDR
Uniprot:: Q8TC59
Synonyme:: cancer/testis antigen 80;CT80;HILI;mili;piwi-like 2;piwi-like protein 2;PIWIL1L;piwil2-like protein;testicular tissue protein Li 141
Weitere Details:: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).