PDK4 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A3069
Zusätzliche Namen:: PDK4
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: STAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM
Uniprot:: Q16654
Synonyme:: [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial;[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial;Pyruvate dehydrogenase kinase isoform 4;pyruvate dehydrogenase kinase, isoenzyme 4;pyruvate dehydrogenase kinase, isozyme 4;pyruvate dehydrogenase, lipoamide, kinase isozyme 4, mitochondrial
Weitere Details:: This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin.