PPAP2A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3062
Zusätzliche Namen:: LLP1a|LPP1|PAP-2a|PAP2|PPAP2A
Anwendung:: ELISA, WB
Molekulargewicht:: 32kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK
Uniprot:: O14494
Synonyme:: Lipid phosphate phosphohydrolase 1;lipid phosphate phosphohydrolase 1a;LLP1a;LPP1;PAP-2a;PAP2;PAP2-alpha;phosphatidate phosphohydrolase type 2a;phosphatidic acid phosphatase 2a;phosphatidic acid phosphatase type 2A;phosphatidic acid phosphohydrolase type 2a;phospholipid phosphatase 1;PPAP2A;type-2 phosphatidic acid phosphatase alpha
Weitere Details:: The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.