14-3-3 gamma Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3043
Zusätzliche Namen:: 14-3-3 gamma|14-3-3GAMMA|DEE56|EIEE56|PPP1R170
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
Uniprot:: P61981
Synonyme:: 14-3-3 protein gamma;14-3-3GAMMA;DEE56;EIEE56;KCIP-1;PPP1R170;protein kinase C inhibitor protein 1;protein phosphatase 1, regulatory subunit 170;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
Weitere Details:: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.