CHRNA10 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3042
Zusätzliche Namen:: CHRNA10
Anwendung:: ELISA, WB
Molekulargewicht:: 45kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
Uniprot:: Q9GZZ6
Synonyme:: acetylcholine receptor, nicotinic, alpha 10 (neuronal);cholinergic receptor, nicotinic alpha 10;cholinergic receptor, nicotinic, alpha 10 (neuronal);cholinergic receptor, nicotinic, alpha polypeptide 10;NACHR alpha-10;neuronal acetylcholine receptor subunit alpha-10;nicotinic acetylcholine receptor subunit alpha-10
Weitere Details:: Predicted to enable acetylcholine-gated cation-selective channel activity. Acts upstream of or within positive regulation of cytosolic calcium ion concentration. Predicted to be located in membrane. Predicted to be active in cholinergic synapse and neuron projection. Predicted to be integral component of postsynaptic specialization membrane.