A3028
ABCC5 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A3028
- Zusätzliche Namen:
- ABC33|ABCC5|EST277145|MOAT-C|MOATC|MRP5|pABC11|SMRP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 185kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRL
- Uniprot:
- O15440
- Synonyme:
- ABC33;ATP-binding cassette sub-family C member 5;ATP-binding cassette, sub-family C (CFTR/MRP), member 5;canalicular multispecific organic anion transporter C;EST277145;MOAT-C;MOATC;MRP5;multi-specific organic anion transporter C;multidrug resistance-associated protein 5;pABC11;SMRP
- Weitere Details:
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

