SLC16A4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A3016
Zusätzliche Namen:: MCT4|MCT5|SLC16A4
Anwendung:: ELISA, WB
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TFPLLMTYTICFAIFAGGYLALILPVLVDLCRNSTVNRFLGLASFFAGMAVLSGPPIAGWLYDYTQTYNGSFYFSGICYLLSSVSFFFVPLAERWKNSLT
Uniprot:: O15374
Synonyme:: MCT 4;MCT 5;MCT4;MCT5;monocarboxylate transporter 4;monocarboxylate transporter 5;solute carrier family 16 (monocarboxylic acid transporters), member 4;Solute carrier family 16 member 4;solute carrier family 16, member 4 (monocarboxylic acid transporter 5)
Weitere Details:: Predicted to enable monocarboxylic acid transmembrane transporter activity. Predicted to be involved in monocarboxylic acid transport. Predicted to be located in membrane. Predicted to be integral component of plasma membrane.