KCNC1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2995
Zusätzliche Namen:: EPM7|KCNC1|KV3.1|KV4|NGK2
Anwendung:: ELISA, WB
Molekulargewicht:: 58kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD
Uniprot:: P48547
Synonyme:: EPM7;KV3.1;KV4;NGK2;potassium channel, voltage gated Shaw related subfamily C, member 1;potassium voltage-gated channel subfamily C member 1;voltage-gated potassium channel protein KV3.1;Voltage-gated potassium channel subunit Kv3.1;voltage-gated potassium channel subunit Kv4
Weitere Details:: This gene encodes a member of a family of integral membrane proteins that mediate the voltage-dependent potassium ion permeability of excitable membranes. Alternative splicing is thought to result in two transcript variants encoding isoforms that differ at their C-termini. These isoforms have had conflicting names in the literature: the longer isoform has been called both "b" and "alpha", while the shorter isoform has been called both "a" and "beta" (PMIDs 1432046, 12091563).