A2991
KLK5 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2991
- Zusätzliche Namen:
- KLK-L2|KLK5|KLKL2|SCTE
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 37kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSH
- Uniprot:
- Q9Y337
- Synonyme:
- kallikrein-5;kallikrein-like protein 2;KLK-L2;KLKL2;SCTE;stratum corneum tryptic enzyme
- Weitere Details:
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its expression is up-regulated by estrogens and progestins. The encoded protein is secreted and may be involved in desquamation in the epidermis. Alternative splicing results in multiple transcript variants encoding the same protein.
- Versandbedingungen:
- Blue Ice

