HMGA2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2972
Zusätzliche Namen:: BABL|HMGA2|HMGI-C|HMGIC|LIPO|SRS5|STQTL9
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
Uniprot:: P52926
Synonyme:: BABL;High mobility group AT-hook protein 2;high mobility group protein HMGI-C;HMGA2/KRT121P fusion;HMGI-C;HMGIC;LIPO;SRS5;STQTL9
Weitere Details:: This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.