A2954
GFRA2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A2954
- Zusätzliche Namen:
- GDNFRB|GFRA2|NRTNR-ALPHA|NTNRA|RETL2|TRNR2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 34kDa/55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL
- Uniprot:
- O00451
- Synonyme:
- GDNF family receptor alpha-2;GDNF receptor beta;GDNFR-alpha-2;GDNFR-beta;GDNFRB;GFR-alpha 2;glial cell line derived neurotrophic factor receptor, beta;neurturin receptor alpha;NRTNR-ALPHA;NTNR-alpha;NTNRA;PI-linked cell-surface accessory protein;RET ligand 2;RETL2;TGF-beta-related neurotrophic factor receptor 2;TRN receptor, GPI-anchored;TRNR2
- Weitere Details:
- Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1. This gene is a candidate gene for RET-associated diseases. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice