GJB3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2949
Zusätzliche Namen:: CX31|DFNA2|DFNA2B|EKV|EKVP1|GJB3
Anwendung:: ELISA, WB
Molekulargewicht:: 31kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV
Uniprot:: O75712
Synonyme:: connexin 31;Connexin-31;CX31;DFNA2;DFNA2B;EKV;EKVP1;gap junction beta-3 protein;gap junction protein, beta 3, 31kDa
Weitere Details:: This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene can cause non-syndromic deafness or erythrokeratodermia variabilis, a skin disorder. Alternative splicing results in multiple transcript variants encoding the same protein.