FOXO1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2934
Zusätzliche Namen:: FKH1|FKHR|FOXO1|FOXO1A
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 80 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSS
Uniprot:: Q12778
Synonyme:: FKH1;FKHR;forkhead box protein O1;forkhead box protein O1A;Forkhead in rhabdomyosarcoma;forkhead, Drosophila, homolog of, in rhabdomyosarcoma;FOXO1A
Weitere Details:: This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.