A2908
EDNRB Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A2908
- Zusätzliche Namen:
- ABCDS|EDNRB|ET-B|ET-BR|ETB|ETB1|ETBR|ETRB|HSCR|HSCR2|WS4A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 49kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETF
- Uniprot:
- P24530
- Synonyme:
- ABCDS;endothelin receptor non-selective type;endothelin receptor subtype B1;endothelin receptor type B;ET-B;ET-BR;ETB;ETB1;ETBR;ETRB;Hirschsprung disease 2;HSCR;HSCR2;WS4A
- Weitere Details:
- The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternative splicing and the use of alternative promoters results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice