A2852
CCL3L1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A2852
- Zusätzliche Namen:
- 464.2|CCL3L1|D17S1718|G0S19-2|LD78|LD78-beta(1-70)|LD78BETA|MIP1AP|SCYA3L|SCYA3L1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
- Uniprot:
- P16619
- Synonyme:
- 464.2;C-C motif chemokine 3-like 1;chemokine (C-C motif) ligand 3-like 1;chemokine (C-C motif) ligand 3-like 3;chemokine (C-C motif) ligand 3-like, centromeric;D17S1718;G0/G1 switch regulatory protein 19-2;G0S19-2;LD78;LD78-beta(1-70);LD78BETA;MIP1AP;PAT 464.2;SCYA3L;SCYA3L1;small inducible cytokine A3-like 1;Small-inducible cytokine A3-like 1;tonsillar lymphocyte LD78 beta protein
- Weitere Details:
- This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this gene binds to several chemokine receptors, including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals, where most individuals have one to six copies, and a minority of individuals have zero or more than six copies. There are conflicting reports about copy number variation of this gene and its correlation to disease susceptibility. This record represents one of two copies that are present on the ALT_REF_LOCI_2 alternate haplotype of the GRCh38 human reference genome assembly. Alternative splicing of this gene results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

