PE Rabbit anti-Rat CD8a monoclonal antibody

Größe

Auf Anfrage

SKU:: A28358
Zusätzliche Namen:: CD8A Alpha|Ly-2|Lyt2|T8
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Rat
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Spezies:: Rat
Sequenz:: GQLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIY
Uniprot:: P07725
Synonyme:: CD8;CD8 antigen 32 kDa chain;CD8 antigen, alpha polypeptide (p32);CD8 antigen, alpha-chain;Leu2;Leu2 T-lymphocyte antigen;OKT8 T-cell antigen;OX-8 membrane antigen;p32;T cell co-receptor;T-cell antigen Leu2;T-cell surface glycoprotein CD8 alpha chain;T-lymphocyte differentiation antigen T8/Leu-2;T8 T-cell antigen
Weitere Details:: CD8a, a 32 kDa glycoprotein also known as T8, Lyt2, Ly-2, and CD8A Alpha, is a member of the immunoglobulin superfamily. It is expressed on most thymocytes, subsets of mature T cells, the majority of NK cells, macrophages, and some activated (non-resting) CD4+ T cells. CD8a forms a heterodimer with the CD8B Beta chain (CD8b) on the surface of most thymocytes. In contrast, mature peripheral T lymphocytes predominantly express the CD8 A AlphaB Beta heterodimer. Intestinal intraepithelial lymphocytes express CD8a but lack CD8b expression. CD8 functions as an antigen co-receptor on T cells, interacting with Major Histocompatibility Complex (MHC) class I molecules on antigen-presenting cells or epithelial cells. CD8 participates in T cell activation by associating with the T cell receptor (TCR) complex and the protein tyrosine kinase lck (p56lck).

Versandbedingungen:: Blue Ice