COL2A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A28341
Zusätzliche Namen:: Col2|Col2a|Col2a-1|Del1|Dmm|Lpk|M100413|Rgsc413|Rgsc856
Anwendung:: ELISA, WB
Molekulargewicht:: 36 kda
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCFL
Uniprot:: P28481
Synonyme:: alpha-1 type II collagen;ANFH;AOM;arthroophthalmopathy, progressive (Stickler syndrome);cartilage collagen;chondrocalcin;Co;COL11A3;Col2;Col2a;Col2a-1;collagen alpha-1(II) chain;collagen II, alpha-1 polypeptide;collagen, type II, alpha 1;Del;Del1;Dmm;L;Lpk;M100413;procollagen, type II, alpha 1;Rgsc4;Rgsc413;Rgsc8;Rgsc856;SEDC;STL1
Weitere Details:: This gene encodes the alpha-1 subunit of the fibril-forming type II collagen, the major component of cartilage and the vitreous humor of the eye. The encoded preproprotein forms homotrimeric, triple helical procollagen that undergoes proteolytic processing during fibirl formation. Mice harboring certain mutations in this gene exhibit severe chondrodysplasia characterized by short limbs and trunch, craniofacial deformities and cleft palate. A complete lack of the encoded protein in mice results in postnatal lethality. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing.

Versandbedingungen:: Blue Ice