CAMP Rabbit polyclonal antibody

Größe

£152.00

SKU:: A28276
Zusätzliche Namen:: CAP-18|CAP18|CRAMP|FALL-39|FALL39|HSD26|LL37
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 16 kDa/18 kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SVRFRVKETVCGKAERQLPEQCAFKEQGVVKQCMGAVTLNPAADSFDISCNEPGAQPFRFKKISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
Uniprot:: P51437
Synonyme:: 18 kDa cationic antimicrobial protein;C;CAP;CAP-18;CAP18;cathelicidin antimicrobial peptide;cathelin-like protein;cathelin-related antimicrobial peptide;CLP;Cnlp;Cr;CRAMP;epididymis secretory sperm binding protein;FAL;FALL-39;FALL39;HSD26;LL37;MC;MCLP
Weitere Details:: This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. The protein plays an important role in innate immunity defense against viruses. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation.