A28276
CAMP Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A28276
- Zusätzliche Namen:
- CAP-18|CAP18|CRAMP|FALL-39|FALL39|HSD26|LL37
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 16 kDa/18 kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SVRFRVKETVCGKAERQLPEQCAFKEQGVVKQCMGAVTLNPAADSFDISCNEPGAQPFRFKKISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
- Uniprot:
- P51437
- Synonyme:
- 18 kDa cationic antimicrobial protein;C;CAP;CAP-18;CAP18;cathelicidin antimicrobial peptide;cathelin-like protein;cathelin-related antimicrobial peptide;CLP;Cnlp;Cr;CRAMP;epididymis secretory sperm binding protein;FAL;FALL-39;FALL39;HSD26;LL37;MC;MCLP
- Weitere Details:
- This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. The protein plays an important role in innate immunity defense against viruses. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation.
- Versandbedingungen:
- Blue Ice



