PE Rabbit anti-Mouse CD301b/MGL2 monoclonal antibody

Größe

Auf Anfrage

SKU:: A28266
Zusätzliche Namen:: CD301b
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP
Uniprot:: Q8JZN1
Synonyme:: C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived);C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived);C-type lectin domain family 10 member A;CD301;CD301b;CLECSF13;CLECSF14;HML;HML2;macrophage galactose N-acetyl-galactosamine specific lectin 2;macrophage galactose-type C-type lectin 2;macrophage lectin 2 (calcium dependent);MGL
Weitere Details:: Enables carbohydrate binding activity. Predicted to be involved in immune response. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including hemolymphoid system gland; ileum; liver; lung; and male reproductive gland or organ. Orthologous to human CLEC10A (C-type lectin domain containing 10A).