PE Rabbit anti-Mouse CD206/MMR monoclonal antibody

Größe

Auf Anfrage

SKU:: A28215
Zusätzliche Namen:: CD206|MR
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYE
Uniprot:: Q61830
Synonyme:: AW259686;bA541I19.1;C-type lectin domain family 13 member D;CD206;CLEC13D;CLEC13DL;hMR;human mannose receptor;M;macrophage mannose receptor 1;macrophage mannose receptor 1-like protein 1;mannose receptor, C type 1-like 1;MMR;MR;MRC1L1
Weitere Details:: Macrophage Mannose Receptor (MMR), also known as MR, is designated CD206, MRC1 (Mannose Receptor C-type 1), or CLEC13D (C-type Lectin Domain Family 13 Member D) due to its presence on cells beyond macrophages. CD206 is a 175 kDa endocytic receptor expressed on M2 selectively activated tissue macrophages, including tumor-associated macrophages (TAMs), inflammatory dendritic cells in specific lymphoid organs, and liver, spleen, lymphatic, and dermal microvascular endothelial cells.