Gata3 Rabbit PolymAb[R]

Größe

Auf Anfrage

SKU:: A28206PM
Zusätzliche Namen:: Gata-3|jal
Anwendung:: ChIP, ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 48 kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VLNGQHPDTHHPGLGHSYMEAQYPLTEEVDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSST
Uniprot:: P23772
Synonyme:: Gata;Gata-3;GATA-binding factor 3;HDR;HDRS;j;jal;trans-acting T-cell-specific transcription factor GATA-3
Weitere Details:: GATA-3 is a transcription factor belonging to the GATA family, which binds to the consensus DNA sequence (A/T)GATA(A/G), controlling various tissue-specific programs of gene expression and morphogenesis. It is widely expressed in tissues derived from the mesoderm and endoderm. GATA-3 has been proven to be an essential regulatory factor for immune cell function, the development of sympathetic neurons, and the maintenance of the differentiation state of epithelial cells.