PE Rabbit anti-Mouse CD235a/Glycophorin A monoclonal antibody

Größe

Auf Anfrage

SKU:: A28200
Zusätzliche Namen:: CD235a|GPA
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV
Uniprot:: P14220
Synonyme:: AI853584;CD235;CD235a;erythroid-lineage-specific membrane sialoglycoprotein;G;glycophorin A (MN blood group);glycophorin A, GPA;glycophorin Erik;glycophorin MiI;glycophorin MiV;glycophorin SAT;glycophorin Sta type C;glycophorin-A;GPA;GPErik;GPSAT;HGpMiV;HGpMiXI;HGpSta(C);Mi.V glycoprotein (24 AA);MN;MN sialoglycoprotein;MNS;PAS-2;recombinant glycophorin A-B Miltenberger-DR;sialoglycoprotein alpha
Weitere Details:: Enables identical protein binding activity. Acts upstream of or within regulation of response to osmotic stress. Located in external side of plasma membrane. Is expressed in liver and yolk sac. Human ortholog(s) of this gene implicated in malaria. Orthologous to several human genes including GYPA (glycophorin A (MNS blood group)).