PE Rabbit anti-Mouse IL-17F monoclonal antibody

Größe

Auf Anfrage

SKU:: A28170
Zusätzliche Namen:: IL-17F
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Uniprot:: Q7TNI7
Synonyme:: C87042;CANDF6;cytokine ML-1;IL-17F;interleukin-17F;ML-1;ML1
Weitere Details:: Enables cytokine receptor binding activity; protein heterodimerization activity; and protein homodimerization activity. Involved in defense response to bacterium and positive regulation of gene expression. Acts upstream of or within positive regulation of cytokine production involved in inflammatory response and positive regulation of transcription by RNA polymerase II. Located in extracellular space. Human ortholog(s) of this gene implicated in chronic mucocutaneous candidiasis. Orthologous to human IL17F (interleukin 17F).