PE Rabbit anti-Chicken CD25 monoclonal antibody

Größe

Auf Anfrage

SKU:: A28169
Zusätzliche Namen:: CD25|IDDM10|Il2r|IMD41|Ly-43|p55|TCGFR
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DKCPRLSTTEFADVAAETYPLKTKLRYECDSGYRRRSGNTLTIRCQNVSGTASWVHDELVCIDEKFLFSRNHTAKLNPTQQPARQTQSPAPPKQANNSSFCGMPQTVPHASLSVHQIYSVGQVLHFKCPTGYNKQLPTTGTITCKNVDGRIKWTPADRPCTNDSGPINKQ
Uniprot:: Q90WJ4
Synonyme:: CD25;IDDM10;IL-2 alpha receptor;IL-2 receptor subunit alpha;IL-2R subunit alpha;IL2 receptor alpha;IL2R;IMD41;interleukin 2 receptor, alpha;interleukin-2 alpha receptor;interleukin-2 receptor subunit alpha;p55;TAC antigen;TCGFR
Weitere Details:: CD25 is the A Alpha chain of the heterotrimeric IL-2 receptor and is highly expressed in many types of hematologic malignancies but shows low expression in most solid tumors. CD25 is also abundantly expressed on activated circulating immune cells and regulatory T cells (Tregs). The infiltration of Tregs into the tumor microenvironment can lead to an imbalance in the ratio of effector T cells (Teffs) to Tregs, which is associated with tumor progression. Restoring a balanced Teff/Treg ratio may enhance the efficacy of immunotherapy. As a potential target for Treg depletion, CD25 plays a critical role in the development of novel immunotherapeutic strategies.

Versandbedingungen:: Blue Ice