PE Rabbit anti-Mouse CD122/IL-2RB Beta monoclonal antibody

Größe

Auf Anfrage

SKU:: A28145
Zusätzliche Namen:: CD122|IL-15Rbeta|Il-2/15Rbeta|Il-2Rbeta|IL15Rbeta|p70
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPA
Uniprot:: P16297
Synonyme:: CD122;CD122 antigen;high affinity IL-2 receptor beta subunit;high affinity IL-2 receptor subunit beta;IL-15 receptor beta chain;IL-15R;IL-15Rbeta;IL-2 receptor beta chain;IL-2 receptor subunit beta;IL-2/15 receptor-beta;Il-2/15Rbeta;Il-2R;IL-2R subunit beta;IL-2RB;Il-2Rbeta;IL15R;IL15RB;IL15Rbeta;IMD63;interleukin 15 receptor, beta;interleukin 2 receptor, beta;interleukin-15 receptor subunit beta;interleukin-2 receptor subunit beta;p70;P70-75;p75
Weitere Details:: The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors.