PE Rabbit anti-Human CD134/OX40 monoclonal antibody

Größe

Auf Anfrage

SKU:: A28036
Zusätzliche Namen:: ACT35|CD134|IMD16|OX40|TXGP1L
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Uniprot:: P43489
Synonyme:: ACT35;ACT35 antigen;ATC35 antigen;CD134;CD134 antigen;IMD16;lymphoid activation antigene ACT35;OX40;OX40 antigen;OX40 cell surface antigen;OX40 homologue;OX40L receptor;TAX transcriptionally-activated glycoprotein 1 receptor;tax-transcriptionally activated glycoprotein 1 receptor;tumor necrosis factor receptor superfamily member 4;TXGP1L
Weitere Details:: CD134, also known as OX40 and TNFRSF4, is a 50 kDa type I transmembrane glycoprotein. It is a member of the tumor necrosis factor receptor superfamily (TNFRSF). OX40 is expressed on activated T lymphocytes, including Th1, Th2, Th17, and Treg cell subsets. The interaction between OX40 and its ligand OX40L (TNFSF4) induces B cell proliferation and antibody secretion, and modulates primary T cell expansion and T cell survival. Furthermore, OX40 influences the size of the T cell memory pool and modulates CD4+ T cell tolerance.

Versandbedingungen:: Blue Ice