A28031
RB Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A28031
- Zusätzliche Namen:
- OSRC|p105-Rb|p110-RB1|pp110|PPP1R130|pRb|RB
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 110 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK
- Uniprot:
- P06400
- Synonyme:
- exon 17 tumor GOS561 substitution mutation causes premature stop;GOS563 exon 17 substitution mutation causes premature stop;OSRC;p105-Rb;p110-RB1;pp110;PPP1R130;pRb;prepro-retinoblastoma-associated protein;protein phosphatase 1, regulatory subunit 130;RB;retinoblastoma 1;retinoblastoma suspectibility protein;retinoblastoma-associated protein
- Weitere Details:
- The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.
- Versandbedingungen:
- Blue Ice







