[KD Validated] Frataxin/FXN Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A28029
Zusätzliche Namen:: CyaY|FA|FARR|FRDA|X25
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 15kDa/19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Uniprot:: Q16595
Synonyme:: CyaY;FA;FARR;frataxin, mitochondrial;FRDA;Friedreich ataxia protein;X25
Weitere Details:: This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants.