Chemerin Rabbit polyclonal antibody

Größe

£152.00

SKU:: A28009
Zusätzliche Namen:: 0610007L05Rik
Anwendung:: ELISA, WB
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALRTK
Uniprot:: Q9DD06
Synonyme:: 0610007L05Rik;AI303516;cheme;chemerin;HP10433;RAR-responsive protein TIG2;retinoic acid receptor responder (tazarotene induced) 2;retinoic acid receptor responder protein 2;tazarotene-induced gene 2 protein;TIG2
Weitere Details:: Predicted to enable signaling receptor binding activity. Involved in several processes, including positive regulation of fat cell differentiation; regulation of insulin receptor signaling pathway; and regulation of primary metabolic process. Acts upstream of or within brown fat cell differentiation. Located in extracellular region. Is expressed in genitourinary system; jaw; and retina. Orthologous to human RARRES2 (retinoic acid receptor responder 2).