CD133 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A28001
Zusätzliche Namen:: 4932416E19Rik|AC133|CD133|Prom|Prom-1|Proml1
Anwendung:: ELISA, WB, IHC-P, IF, IP
Molekulargewicht:: 120 kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EGQPAFHNTPGAMNYELPTTKYETQDTFNAGIVGPLYKMVHIFLNVVQPNDFPLDLIKKLIQNKNFDISVDSKEPEIIVLALKIALYE
Uniprot:: O54990
Synonyme:: 4932416E19Rik;AC13;AC133;antigen AC133;antigen AC133 homolog;CD133;CORD12;hematopoietic stem cell antigen;hProminin;MCDR2;MSTP061;P;Pro;Prom;Prom-1;prominin-1;prominin-like 1;prominin-like protein 1;PROML1;RP41;STGD4
Weitere Details:: Predicted to enable actinin binding activity; cadherin binding activity; and cholesterol binding activity. Involved in camera-type eye photoreceptor cell differentiation and retina layer formation. Located in several cellular components, including brush border; photoreceptor outer segment; and prominosome. Is expressed in several structures, including brain; eye; genitourinary system; intestine; and neural ectoderm. Used to study retinitis pigmentosa 41. Human ortholog(s) of this gene implicated in cone-rod dystrophy 12; retinal macular dystrophy 2; and retinitis pigmentosa 41. Orthologous to human PROM1 (prominin 1).