PE Rabbit anti-Mouse CD163 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27962
Zusätzliche Namen:: CD163v2|CD163v3|M130
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VTNAPGEMKKELRLAGGENNCSGRVELKIHDKWGTVCSNGWSMNEVSVVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEG
Uniprot:: Q2VLH6
Synonyme:: CD163v2;CD163v3;hemoglobin scavenger receptor;M130;macrophage-associated antigen;MM130;SCARI1;scavenger receptor cysteine-rich type 1 protein M130
Weitere Details:: CD163 is a member of the Group B scavenger receptor cysteine-rich (SRCR) superfamily. It is also known as GHI/61, M130, RM3/1, p155, the hemoglobin-haptoglobin complex receptor, or macrophage-associated antigen.It is a glycoprotein with an apparent molecular weight of 134 kDa under non-reducing conditions and 155 kDa under reducing conditions. CD163 is predominantly expressed on macrophages, Kupffer cells, monocytes, subsets of dendritic cells, and subsets of hematopoietic stem/progenitor cells.CD163 binds the haptoglobin-hemoglobin (Hp-Hb) complex and TNF-like weak inducer of apoptosis (TWEAK). It serves as the receptor for hemoglobin scavenging and modulates cytokine production by macrophages.Membrane-bound CD163 can be proteolytically cleaved by metalloproteinases (e.g., ADAM17, MMPs), releasing its soluble form (sCD163). Elevated serum levels of sCD163 have been strongly associated with numerous inflammatory diseases.

Versandbedingungen:: Blue Ice