APC Rabbit anti-Human/Monkey Ki67 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27946
Zusätzliche Namen:: KIA|MIB-|MIB-1|PPP1R105
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PAGGDEKDMKAFMGTPVQKLDLPGNLPGSKRWPQTPKEKAQALEDLAGFKELFQTPGTDKPTTDEKTTKIACKSPQPDPVDTPASTKQRPKRNLRKADVE
Uniprot:: P46013
Synonyme:: antigen identified by monoclonal antibody Ki-67;antigen Ki67;KIA;MIB-;MIB-1;Molecular Immunology Borstel antibody 1;PPP1R105;proliferation marker protein Ki-67;proliferation-related Ki-67 antigen;protein phosphatase 1, regulatory subunit 105
Weitere Details:: Enables protein C-terminus binding activity. Involved in regulation of chromosome segregation and regulation of mitotic nuclear division. Located in chromosome; nuclear body; and nucleolus. Colocalizes with condensed chromosome. Implicated in Crohn's disease; breast cancer; human immunodeficiency virus infectious disease; and pancreatic cancer. Biomarker of several diseases, including Barrett's esophagus; autoimmune disease of musculoskeletal system (multiple); endocrine gland cancer (multiple); gastrointestinal system cancer (multiple); and interstitial cystitis.