PE Rabbit anti-Human CD205/DEC-205 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27942
Zusätzliche Namen:: CD205|CLEC13B|DEC-205|GP200-MR6|LY-75
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CEDNWEKNEQFGSCYQFNTQTALSWKEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFLNWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTRCDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEEVWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEKLKYVCKRKGEKLNDASSDKMC
Uniprot:: O60449
Synonyme:: C-type lectin domain family 13 member B;CD205;CLEC13B;DEC-205;DEC-205/DCL-1 fusion;GP200-MR6;LY-75;LY75;LY75-CD302 fusion protein;lymphocyte antigen 75
Weitere Details:: CD205 is a 210-kDa type C lectin transmembrane protein, also known as DEC-205. It belongs to the macrophage mannose receptor family and is highly expressed in dendritic cells and thymic epithelial cells. Unlike murine CD205, human CD205 is also expressed at low levels on T cells, B cells, NK cells, and monocytes. CD205 functions as an endocytic receptor involved in antigen uptake/processing and the clearance of apoptotic cells.