[KD Validated] CDK2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27938
Zusätzliche Namen:: CDKN2|p33(CDK2)
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 33 kDa/38 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Uniprot:: P24941
Synonyme:: cdc2-related protein kinase;CDKN2;cell division protein kinase 2;cyclin-dependent kinase 2;p33 protein kinase;p33(CDK2)
Weitere Details:: This gene encodes a member of a family of serine/threonine protein kinases that participate in cell cycle regulation. The encoded protein is the catalytic subunit of the cyclin-dependent protein kinase complex, which regulates progression through the cell cycle. Activity of this protein is especially critical during the G1 to S phase transition. This protein associates with and regulated by other subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A), and p27Kip1 (CDKN1B). Alternative splicing results in multiple transcript variants.