ABflo[R] 700 Rabbit anti-Human CD303/BDCA-2 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27912
Zusätzliche Namen:: BDCA-2|BDCA2|CD303|CLECSF11|CLECSF7|DLEC|HECL|PRO34150
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Uniprot:: Q8WTT0
Synonyme:: BDCA-2;BDCA2;Blood dendritic cell antigen 2;blood dendritic cell antigen 2 protein;C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 11;C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 7;C-type lectin domain family 4 member C;C-type lectin superfamily member 7;CD303;CLECSF11;CLECSF7;dendritic cell lectin b;dendritic lectin;DLEC;HECL;PRO34150
Weitere Details:: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.

Versandbedingungen:: Blue Ice