HDAC6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A27908
Zusätzliche Namen:: Hd6|Hdac5|mHDA2|Sfc6
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 140kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKMEDKEECSSSRLVIKKLPPTASPVSAKEMTTPKGKVPEESVRKTIAALPGKESTLGQAKSKMAKAVLAQGQSSEQAAKGTTLDLATSKETVGGATTDLWASAAAPENFPNQTTSVEALGETEPTPPASHTNKQTTGASPLQGVTAQQSLQLGVLSTLELSREAEEAHDSEEGLLGEAAGGQDMNSLMLTQGFGDFNTQDV
Uniprot:: Q9Z2V5
Synonyme:: CPBHM;HD6;Hdac5;histone deacetylase 5;histone deacetylase 6;histone deacetylase mHDA2;JM21;mHDA;mHDA2;PPP1R90;protein phosphatase 1, regulatory subunit 90;scurfy candidate 6;Sfc;Sfc6;tubulin-lysine deacetylase HDAC6
Weitere Details:: Enables several functions, including cytoskeletal protein binding activity; protein lysine deacetylase activity; and ubiquitin binding activity. Involved in several processes, including positive regulation of type 2 mitophagy; protein destabilization; and tubulin deacetylation. Acts upstream of or within several processes, including aggresome assembly; neuron projection morphogenesis; and protein modification process. Located in several cellular components, including dendrite; microtubule cytoskeleton; and perikaryon. Part of cytoplasmic ubiquitin ligase complex. Is expressed in several structures, including central nervous system; early embryo; gut gland; lung; and metanephros. Human ortholog(s) of this gene implicated in chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia and polycystic liver disease 1. Orthologous to human HDAC6 (histone deacetylase 6).

Versandbedingungen:: Blue Ice