IKK beta Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27876
Zusätzliche Namen:: IKK-2|IKK-beta|IKK2|IKKB|IMD15|IMD15A|IMD15B|NFKBIKB
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 97 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVS
Uniprot:: O14920
Synonyme:: I-kappa-B kinase 2;I-kappa-B-kinase beta;IKK-beta;IKK2;IKKB;IMD15;IMD15A;IMD15B;inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta;inhibitor of nuclear factor kappa-B kinase subunit beta;NFKBIKB;nuclear factor NF-kappa-B inhibitor kinase beta;serine/threonine protein kinase IKBKB
Weitere Details:: The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene.