[KO Validated] Calnexin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27819
Zusätzliche Namen:: CNX|IP90|P90
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 90kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKY
Uniprot:: P27824
Synonyme:: calnexin;CNX;epididymis secretory sperm binding protein;IP90;major histocompatibility complex class I antigen-binding protein p88;P90
Weitere Details:: This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described.