[KD Validated] TRADD Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27817
Zusätzliche Namen:: Hs.89862
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 35 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
Uniprot:: Q15628
Synonyme:: Hs.89862;TNFR1-associated death domain protein;TNFRSF1A-associated via death domain;tumor necrosis factor receptor type 1 associated death domain protein;tumor necrosis factor receptor type 1-associated DEATH domain protein;tumor necrosis factor receptor-1-associated protein
Weitere Details:: The protein encoded by this gene is a death domain containing adaptor molecule that interacts with TNFRSF1A/TNFR1 and mediates programmed cell death signaling and NF-kappaB activation. This protein binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thus suppresses TRAF2 mediated apoptosis. This protein can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway.