[KO Validated] Abhd6 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27794
Zusätzliche Namen:: 0610041D24Rik|AA673485|ABHD6|AV065425
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSIVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYSTDNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNSFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEVLENCGHSVVMERPRK
Uniprot:: Q8R2Y0
Synonyme:: 0610041D24Rik;2-arachidonoylglycerol hydrolase;AA673485;abhydrolase domain-containing protein 6;AV065425;lipase protein;monoacylglycerol lipase ABHD6
Weitere Details:: Enables monoacylglycerol lipase activity. Involved in acylglycerol catabolic process. Predicted to be located in late endosome membrane and lysosomal membrane. Predicted to be part of AMPA glutamate receptor complex. Predicted to be active in GABA-ergic synapse; glutamatergic synapse; and postsynaptic membrane.