[KD Validated] NOX1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27773
Zusätzliche Namen:: GP91-2|MOX1|NOH-1|NOH-1L|NOH1
Anwendung:: ELISA, WB
Molekulargewicht:: 65kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPF
Uniprot:: Q9Y5S8
Synonyme:: GP91-2;mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating);mitogenic oxidase 1;MOX1;NADH/NADPH mitogenic oxidase subunit P65-MOX;NADPH oxidase 1;NADPH oxidase homolog-1;NOH-1;NOH1
Weitere Details:: This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.