PI3K-gamma Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27717
Zusätzliche Namen:: IMD97|p110gamma|p120-PI3K|PI3CG|PI3K|PI3Kgamma|PIK3
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RSPGQIHLVQRHPPSEESQAFQRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHPWVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIH
Uniprot:: P48736
Synonyme:: 1-phosphatidylinositol 3-kinase;p110gamma;p120-PI3K;phosphatidylinositol 3 kinase gamma, p110 gamma;phosphatidylinositol 3-kinase catalytic 110-kD gamma;Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma;phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform;phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma;Phosphoinositide-3-kinase catalytic gamma polypeptide;phosphoinositide-3-kinase gamma catalytic subunit;PI3-kinase subunit gamma;PI3CG;PI3K;PI3Kgamma;PIK3;ptdIns-3-kinase subunit gamma;ptdIns-3-kinase subunit p110-gamma;serine/threonine protein kinase PIK3CG
Weitere Details:: Phosphoinositide 3-kinases (PI3Ks) phosphorylate inositol lipids and are involved in the immune response. The protein encoded by this gene is a class I catalytic subunit of PI3K. Like other class I catalytic subunits (p110-alpha p110-beta, and p110-delta), the encoded protein binds a p85 regulatory subunit to form PI3K. This gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias. Several transcript variants encoding the same protein have been found for this gene.

Versandbedingungen:: Blue Ice