Synaptophysin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27659
Zusätzliche Namen:: MRX96|SYN|SYP
Anwendung:: ELISA, WB, IHC-P, IF, IP
Molekulargewicht:: 38 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
Uniprot:: P08247
Synonyme:: major synaptic vesicle protein P38;MRX96;MRXSYP;synaptophysin;XLID96
Weitere Details:: Synaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for the identification of neuroendocrine cells and neoplasms. Synaptic proteins including synaptophysin are reduced in brain tissue from patients with Alzheimer's disease.(PMID: 3010302; 21658579)