ABflo[R] 647 Rabbit anti-Pig CD138/Syndecan-1 monoclonal antibody

Größe

Auf Anfrage

SKU:: A27636
Zusätzliche Namen:: SDC1,syndecan-1
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Porcine
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Porcine
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Spezies:: Porcine
Sequenz:: ETVATNVPPEDQDGSGDDSDNFSGSGAGALPDVTLSQQTPSTWKDTGLLTTMPTAPEPTSPDTVATSTSVLPAGERPGRGRAVLLDLDPGLTAQEKEATHSPSETTQHPTTHRASTAGATTAQVPATSHPHRDVPPDHPETSAPAGHGQLDPHTPGVGDGGPATTEKAAEGEASTQLPVGEGSGEPDFTFDVSGENTAGDALDPDQRNEPPVDQGTTGASQSLLDRKE
Uniprot:: K7GNF5
Synonyme:: CD138;CD138 antigen;heparan sulfate proteoglycan fibroblast growth factor receptor;SDC;SYND1;syndecan;syndecan proteoglycan 1;syndecan-1
Weitere Details:: Predicted to enable identical protein binding activity and protein C-terminus binding activity. Involved in myoblast development. Acts upstream of or within canonical Wnt signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; egg cylinder; sensory organ; skin; and urinary system. Orthologous to human SDC1 (syndecan 1).