ABflo[R] 647 Rabbit anti-Human CD85d/e/i/j monoclonal antibody

Größe

Auf Anfrage

SKU:: A27608
Zusätzliche Namen:: CD85D|ILT-4|ILT4|LIR-2|LIR2|MIR-10|MIR10
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGVV
Uniprot:: O75019, Q8N423, Q8N6C8, Q8NHL6
Synonyme:: CD85 antigen-like family member D;CD85 antigen-like family member E;CD85 antigen-like family member I;CD85 antigen-like family member J;CD85D;CD85E;CD85I;CD85J;HM31;HM43;Ig-like transcript 2;Ig-like transcript 4;ILT-2;ILT-4;ILT-6;ILT2;ILT4;ILT6;immunoglobulin heavy chain variable region;Immunoglobulin-like transcript 2;Immunoglobulin-like transcript 4;immunoglobulin-like transcript 6;leucocyte Ig-like receptor A1;leucocyte Ig-like receptor A3;leucocyte Ig-like receptor B1;leucocyte Ig-like receptor B2;leukocyte immunoglobulin-like receptor 4;leukocyte immunoglobulin-like receptor 6;leukocyte immunoglobulin-like receptor subfamily A member 1;leukocyte immunoglobulin-like receptor subfamily A member 3;leukocyte immunoglobulin-like receptor subfamily B member 1;leukocyte immunoglobulin-like receptor subfamily B member 2;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1;leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1;leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2;LIR-1;LIR-2;LIR-4;LIR-6;LIR1;LIR2;LIR4;LIR6;MIR-10;MIR-7;MIR10;MIR7;monocyte inhibitory receptor HM43/HM31;monocyte/macrophage immunoglobulin-like receptor 10;monocyte/macrophage immunoglobulin-like receptor 7;myeloid inhibitory receptor 10;myeloid inhibitory receptor 7;PIR-B;PIRB
Weitere Details:: This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice