A27588
DNMT3B Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A27588
- Zusätzliche Namen:
- FSHD4|ICF|ICF1|M.HsaIIIB
- Anwendung:
- ChIP, ELISA, WB
- Molekulargewicht:
- 80-105kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKS
- Uniprot:
- Q9UBC3
- Synonyme:
- DNA (cytosine-5-)-methyltransferase 3 beta;DNA (cytosine-5)-methyltransferase 3B;DNA cytosine-5--methyltransferase 3 beta;DNA methyltransferase HsaIIIB;DNA MTase HsaIIIB;FSHD4;ICF;ICF1;M.HsaIIIB
- Weitere Details:
- CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined.
- Versandbedingungen:
- Blue Ice



