[KD Validated] ROMO1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A27581
Zusätzliche Namen:: MTGM, MTGMP, C20orf52, bA353C18.2, ROMO1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 10kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
Uniprot:: P60602
Synonyme:: bA353C18.2;C20orf52;epididymis tissue protein Li 175;glyrichin;mitochondrial targeting GxxxG motif protein;mitochondrial targeting GXXXG protein;MTGM;MTGMP;PCM19;protein MGR2 homolog;reactive oxygen species modulator 1;ROS modulator 1
Weitere Details:: The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage.